Products

BMP-15 (Bone morphogenetic protein-15), Human

Bone morphogenetic protein 15 is a protein, that in humans, is encoded by the BMP15 gene. It's mainly involved in folliculogenesis. The protein encoded by this gene is a member of the TGF-β superfamily. It is a paracrine signaling molecule involved in oocyte and follicular development. Using Northern blot analysis, BMP15 has been shown to be exclusively expressed in the ovaries. This protein may be involved in oocyte maturation and follicular development as a homodimer or by forming heterodimers with a related protein, Gdf9.
No. Size Price Qty Status
C01076-5UG 5 ug $108.00 Inquiry
C01076-20UG 20 ug $268.00 Inquiry
C01076-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
MQADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCV
PYKYVPISVLMIEANGSILYKEYEGMIAESCTCR with polyhistidine tag at the C-terminus

UnitProt ID:
O95972
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <17 ng/mL.
 
Purity:
>98% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in 4 mM HCl to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <17 ng/mL.
Reviews for BMP-15 (Bone morphogenetic protein-15), Human

Average Rating: 0 (0 Reviews )